Lineage for d2b05c_ (2b05 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339527Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2339528Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2339586Protein automated matches [190238] (10 species)
    not a true protein
  7. 2339604Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2339646Domain d2b05c_: 2b05 C: [162957]
    automated match to d1qjaa_

Details for d2b05c_

PDB Entry: 2b05 (more details), 2.55 Å

PDB Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
PDB Compounds: (C:) 14-3-3 protein gamma

SCOPe Domain Sequences for d2b05c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b05c_ a.118.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d2b05c_:

Click to download the PDB-style file with coordinates for d2b05c_.
(The format of our PDB-style files is described here.)

Timeline for d2b05c_: