SCOPe 2.07: Domain d2amua1: 2amu A:1-131

Lineage for d2amua1 (2amu A:1-131)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.0: automated matches [191383] (1 protein)
   not a true family

6. Protein automated matches [190481] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187409] (2 PDB entries)

8. Domain d2amua1: 2amu A:1-131 [162840]
   Other proteins in same PDB: d2amua2
   automated match to d1do6a_
   complexed with fe

Details for d2amua1

PDB Entry: 2amu, 2 Å

PDB Description: crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 2.00 a resolution

PDB Compounds: (A:) Putative superoxide reductase

SCOPe Domain Sequences for d2amua1:

Sequence; same for both SEQRES and ATOM records:

>d2amua1 b.1.13.0 (A:1-131) automated matches {Thermotoga maritima [TaxId: 2336]}
mklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvff
qpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihgl
wessqkitvee

Timeline for d2amua1:

• d2amua1 first appeared in SCOPe 2.01, called d2amua_
  
• d2amua1 appears in SCOPe 2.06
  
• d2amua1 appears in the current release, SCOPe 2.08