Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
Species Escherichia coli [TaxId:562] [69768] (14 PDB entries) Uniprot P62617 ! Uniprot P36663 |
Domain d2amtb_: 2amt B: [162835] automated match to d1h48c_ complexed with 1aa, gpp, zn |
PDB Entry: 2amt (more details), 2.3 Å
SCOPe Domain Sequences for d2amtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amtb_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl gchmddvnvkattteklgftgrgegiaceavallik
Timeline for d2amtb_: