Lineage for d2ak5b_ (2ak5 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536478Protein automated matches [190043] (6 species)
    not a true protein
  7. 1536544Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)
  8. 1536552Domain d2ak5b_: 2ak5 B: [162825]
    automated match to d1ujya_

Details for d2ak5b_

PDB Entry: 2ak5 (more details), 1.85 Å

PDB Description: beta PIX-SH3 complexed with a Cbl-b peptide
PDB Compounds: (B:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2ak5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak5b_ b.34.2.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
ikps

SCOPe Domain Coordinates for d2ak5b_:

Click to download the PDB-style file with coordinates for d2ak5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ak5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ak5a_