Lineage for d1hjp_1 (1hjp 158-203)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211141Fold a.5: RuvA C-terminal domain-like [46928] (5 superfamilies)
    3 helices; bundle, right-handed twist
  4. 211142Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 211143Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 211144Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 211145Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 211147Domain d1hjp_1: 1hjp 158-203 [16274]
    Other proteins in same PDB: d1hjp_2, d1hjp_3

Details for d1hjp_1

PDB Entry: 1hjp (more details), 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli

SCOP Domain Sequences for d1hjp_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjp_1 a.5.1.1 (158-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli}
daeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOP Domain Coordinates for d1hjp_1:

Click to download the PDB-style file with coordinates for d1hjp_1.
(The format of our PDB-style files is described here.)

Timeline for d1hjp_1: