![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (5 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) ![]() possibly related to UBA-like domains |
![]() | Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein) |
![]() | Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species) tetramer; binds Holliday junction |
![]() | Species Escherichia coli [TaxId:562] [46932] (4 PDB entries) |
![]() | Domain d1hjp_1: 1hjp 158-203 [16274] Other proteins in same PDB: d1hjp_2, d1hjp_3 |
PDB Entry: 1hjp (more details), 2.5 Å
SCOP Domain Sequences for d1hjp_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjp_1 a.5.1.1 (158-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli} daeqeavaalvalgykpqeasrmvskiarpdassetlirealraal
Timeline for d1hjp_1: