![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [89611] (7 PDB entries) |
![]() | Domain d1zh6a_: 1zh6 A: [162473] automated match to d1j1ua_ protein/RNA complex; complexed with 4af, bme |
PDB Entry: 1zh6 (more details), 2.5 Å
SCOPe Domain Sequences for d1zh6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh6a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]} mdefemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagf diiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr lalkttlkrarrsmeliaredenpkvaeviypimqvngchyrgvdvavggmeqrkihmla rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile pirkrll
Timeline for d1zh6a_: