SCOPe 2.03: Domain d1z1qa_: 1z1q A:

Lineage for d1z1qa_ (1z1q A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)

8. Domain d1z1qa_: 1z1q A: [162360]
   automated match to d1qyoa_
   complexed with na

Details for d1z1qa_

PDB Entry: 1z1q, 1.5 Å

PDB Description: y66l variant of enhanced green fluorescent protein with 374-nm absorbing chromophore

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1z1qa_:

Sequence; same for both SEQRES and ATOM records:

>d1z1qa_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttltlgvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d1z1qa_:

• d1z1qa_ first appeared in SCOPe 2.01
  
• d1z1qa_ appears in SCOPe 2.02
  
• d1z1qa_ appears in SCOPe 2.04
  
• d1z1qa_ appears in the current release, SCOPe 2.08