Lineage for d1ywtb_ (1ywt B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339527Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2339528Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2339586Protein automated matches [190238] (10 species)
    not a true protein
  7. 2339604Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2339641Domain d1ywtb_: 1ywt B: [162320]
    automated match to d1qjba_
    complexed with ca

Details for d1ywtb_

PDB Entry: 1ywt (more details), 2.4 Å

PDB Description: Crystal structure of the human sigma isoform of 14-3-3 in complex with a mode-1 phosphopeptide
PDB Compounds: (B:) 14-3-3 protein sigma

SCOPe Domain Sequences for d1ywtb_:

Sequence, based on SEQRES records: (download)

>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqkspevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdyyr
ylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspee
aislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d1ywtb_:

Click to download the PDB-style file with coordinates for d1ywtb_.
(The format of our PDB-style files is described here.)

Timeline for d1ywtb_: