Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries) |
Domain d1ywtb_: 1ywt B: [162320] automated match to d1qjba_ complexed with ca |
PDB Entry: 1ywt (more details), 2.4 Å
SCOPe Domain Sequences for d1ywtb_:
Sequence, based on SEQRES records: (download)
>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr vlssieqkspevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdyyr ylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspee aislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
Timeline for d1ywtb_: