Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (8 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries) |
Domain d1ywoa_: 1ywo A: [162316] automated match to d1hsqa_ |
PDB Entry: 1ywo (more details), 1.81 Å
SCOPe Domain Sequences for d1ywoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywoa_ b.34.2.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} savkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyvee
Timeline for d1ywoa_: