Lineage for d1yjxg_ (1yjx G:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1377357Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1377358Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1377359Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1377411Protein automated matches [190196] (7 species)
    not a true protein
  7. 1377431Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries)
  8. 1377458Domain d1yjxg_: 1yjx G: [162225]
    automated match to d1e58a_
    complexed with cit, cl

Details for d1yjxg_

PDB Entry: 1yjx (more details), 2.8 Å

PDB Description: Crystal structure of human B type phosphoglycerate mutase
PDB Compounds: (G:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d1yjxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjxg_ c.60.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk
ameav

SCOPe Domain Coordinates for d1yjxg_:

Click to download the PDB-style file with coordinates for d1yjxg_.
(The format of our PDB-style files is described here.)

Timeline for d1yjxg_: