Lineage for d1ye4a_ (1ye4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2438186Protein Xylose reductase [75058] (1 species)
  7. 2438187Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2438206Domain d1ye4a_: 1ye4 A: [162181]
    automated match to d1jeza_
    complexed with nad, so4; mutant

Details for d1ye4a_

PDB Entry: 1ye4 (more details), 2.4 Å

PDB Description: crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
PDB Compounds: (A:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d1ye4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ye4a_ c.1.7.1 (A:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

SCOPe Domain Coordinates for d1ye4a_:

Click to download the PDB-style file with coordinates for d1ye4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ye4a_: