Lineage for d1x1va_ (1x1v A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422754Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2422755Protein automated matches [190516] (5 species)
    not a true protein
  7. 2422765Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)
  8. 2422780Domain d1x1va_: 1x1v A: [162029]
    automated match to d1c3ka_
    complexed with hez, mma, zn

Details for d1x1va_

PDB Entry: 1x1v (more details), 2.45 Å

PDB Description: structure of banana lectin- methyl-alpha-mannose complex
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1x1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1va_ b.77.3.0 (A:) automated matches {Musa acuminata [TaxId: 4641]}
aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
ffgrggdfidaigvylep

SCOPe Domain Coordinates for d1x1va_:

Click to download the PDB-style file with coordinates for d1x1va_.
(The format of our PDB-style files is described here.)

Timeline for d1x1va_: