Lineage for d1x12d_ (1x12 D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1376154Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 1376155Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 1376156Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 1376170Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)
  8. 1376174Domain d1x12d_: 1x12 D: [162027]
    automated match to d1ioia_
    mutant

Details for d1x12d_

PDB Entry: 1x12 (more details), 2 Å

PDB Description: structure of mutant pyrrolidone carboxyl peptidase (e192d) from a hyperthermophile, pyrococcus furiosus
PDB Compounds: (D:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d1x12d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x12d_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemdleavkvaievaleell

SCOPe Domain Coordinates for d1x12d_:

Click to download the PDB-style file with coordinates for d1x12d_.
(The format of our PDB-style files is described here.)

Timeline for d1x12d_: