SCOPe 2.03: Domain d1uppk_: 1upp K:

Lineage for d1uppk_ (1upp K:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)

8. Domain d1uppk_: 1upp K: [161822]
   Other proteins in same PDB: d1uppa1, d1uppa2, d1uppc1, d1uppc2, d1uppe1, d1uppe2, d1uppg1, d1uppg2
   automated match to d1aa1c_
   complexed with ca, cap

Details for d1uppk_

PDB Entry: 1upp, 2.3 Å

PDB Description: spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.

PDB Compounds: (K:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1uppk_:

Sequence; same for both SEQRES and ATOM records:

>d1uppk_ d.73.1.1 (K:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1uppk_:

• d1uppk_ first appeared in SCOPe 2.01
  
• d1uppk_ appears in SCOPe 2.02
  
• d1uppk_ appears in SCOPe 2.04
  
• d1uppk_ appears in the current release, SCOPe 2.08