SCOPe 2.07: Domain d1t2ja1: 1t2j A:2-113

Lineage for d1t2ja1 (1t2j A:2-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d1t2ja1: 1t2j A:2-113 [161745]
   Other proteins in same PDB: d1t2ja2
   automated match to d1vhpa_
   complexed with peg

Details for d1t2ja1

PDB Entry: 1t2j, 1.5 Å

PDB Description: Crystal structure of a Human VH domain

PDB Compounds: (A:) M12-Variable Heavy domain

SCOPe Domain Sequences for d1t2ja1:

Sequence; same for both SEQRES and ATOM records:

>d1t2ja1 b.1.1.1 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntysa
dsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss

Timeline for d1t2ja1:

• d1t2ja1 first appeared in SCOPe 2.01, called d1t2ja_
  
• d1t2ja1 was called d1t2ja_ in SCOPe 2.06
  
• d1t2ja1 appears in the current release, SCOPe 2.08