Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d1t2ja1: 1t2j A:2-113 [161745] Other proteins in same PDB: d1t2ja2 automated match to d1vhpa_ complexed with peg |
PDB Entry: 1t2j (more details), 1.5 Å
SCOPe Domain Sequences for d1t2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2ja1 b.1.1.1 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntysa dsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss
Timeline for d1t2ja1: