Lineage for d3bhvc_ (3bhv C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434070Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434071Species Human (Homo sapiens) [TaxId:9606] [88856] (335 PDB entries)
    Uniprot P24941
  8. 1434282Domain d3bhvc_: 3bhv C: [161613]
    Other proteins in same PDB: d3bhvb1, d3bhvb2, d3bhvd1, d3bhvd2
    automated match to d1ogua_
    complexed with mg, sgm, var

Details for d3bhvc_

PDB Entry: 3bhv (more details), 2.1 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor variolin B
PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d3bhvc_:

Sequence, based on SEQRES records: (download)

>d3bhvc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records): (download)

>d3bhvc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtfskvvppldedgrslls
qmlhydpnkrisakaalahpffqdvtkpvphl

SCOPe Domain Coordinates for d3bhvc_:

Click to download the PDB-style file with coordinates for d3bhvc_.
(The format of our PDB-style files is described here.)

Timeline for d3bhvc_: