Lineage for d1qnta1 (1qnt A:92-176)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) 
automatically mapped to Pfam PF01035
Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
Uniprot P16455 6-176
Domain d1qnta1: 1qnt A:92-176 [16074]
Other proteins in same PDB: d1qnta2
Details for d1qnta1
PDB Entry: 1qnt (more details), 1.9 Å
PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferaseSCOPe Domain Sequences for d1qnta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnta1 a.4.2.1 (A:92-176) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrl
SCOPe Domain Coordinates for d1qnta1:
Click to download the PDB-style file with coordinates for d1qnta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qnta1:
- d1qnta1 first appeared (with stable ids) in SCOP 1.55
- d1qnta1 appears in SCOPe 2.07
View in 3D
