Lineage for d1ork_1 (1ork 2-67)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533063Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
  6. 533143Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 533144Species Escherichia coli [TaxId:562] [46766] (9 PDB entries)
  8. 533149Domain d1ork_1: 1ork 2-67 [16067]
    Other proteins in same PDB: d1ork_2
    class d variant
    complexed with atc, mg; mutant

Details for d1ork_1

PDB Entry: 1ork (more details), 2.4 Å

PDB Description: tet repressor, class d in complex with 9-(n,n-dimethylglycylamido)-6-demethyl-6-deoxy-tetracycline

SCOP Domain Sequences for d1ork_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ork_1 a.4.1.9 (2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d1ork_1:

Click to download the PDB-style file with coordinates for d1ork_1.
(The format of our PDB-style files is described here.)

Timeline for d1ork_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ork_2