Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins) duplication: consists of two structural repeats bipartite HTH protein |
Protein Rob transcription factor, N-terminal domain [46762] (1 species) |
Species Escherichia coli [TaxId:562] [46763] (1 PDB entry) |
Domain d1d5yb1: 1d5y B:3-56 [16057] Other proteins in same PDB: d1d5ya3, d1d5yb3, d1d5yc3, d1d5yd3 protein/DNA complex |
PDB Entry: 1d5y (more details), 2.7 Å
SCOPe Domain Sequences for d1d5yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5yb1 a.4.1.8 (B:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayira
Timeline for d1d5yb1: