Lineage for d1ret__ (1ret -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351364Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 351365Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 351366Species Escherichia coli [TaxId:562] [46732] (3 PDB entries)
  8. 351369Domain d1ret__: 1ret - [16024]

Details for d1ret__

PDB Entry: 1ret (more details)

PDB Description: determination of the structure of the dna binding domain of gamma delta resolvase in solution

SCOP Domain Sequences for d1ret__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ret__ a.4.1.2 (-) gamma,delta resolvase (C-terminal domain) {Escherichia coli}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOP Domain Coordinates for d1ret__:

Click to download the PDB-style file with coordinates for d1ret__.
(The format of our PDB-style files is described here.)

Timeline for d1ret__: