Lineage for d1akha_ (1akh A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351238Family a.4.1.1: Homeodomain [46690] (22 proteins)
  6. 351308Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 351309Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)
  8. 351310Domain d1akha_: 1akh A: [15980]
    Other proteins in same PDB: d1akhb_
    protein/DNA complex

Details for d1akha_

PDB Entry: 1akh (more details), 2.5 Å

PDB Description: mat a1/alpha2/dna ternary complex

SCOP Domain Sequences for d1akha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akha_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
ispqarafleevfrrkqslnskekeevakkcgitplqvrvwfinkrmrs

SCOP Domain Coordinates for d1akha_:

Click to download the PDB-style file with coordinates for d1akha_.
(The format of our PDB-style files is described here.)

Timeline for d1akha_:

351310
d1akha_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1akhb_