SCOP 1.63: Domain d1fcdd1: 1fcd D:1-80

Lineage for d1fcdd1 (1fcd D:1-80)

Root: SCOP 1.63
Class a: All alpha proteins [46456] (171 folds)
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, opened
Superfamily a.3.1: Cytochrome c [46626] (8 families)
covalently-bound heme completes the core
Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
duplication: consists of two cytochrome c type domains
Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)
Species Purple phototrophic bacterium (Chromatium vinosum) [TaxId:1049] [46684] (1 PDB entry)
Domain d1fcdd1: 1fcd D:1-80 [15968]
Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3

Details for d1fcdd1

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

SCOP Domain Sequences for d1fcdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdd1 a.3.1.4 (D:1-80) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Purple phototrophic bacterium (Chromatium vinosum)}
eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
ystadfekmagyfkqqtyqp

SCOP Domain Coordinates for d1fcdd1:

Click to download the PDB-style file with coordinates for d1fcdd1.
(The format of our PDB-style files is described here.)

Timeline for d1fcdd1: