Lineage for d1hj3b1 (1hj3 B:26-133)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760954Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 760955Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 760961Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 760968Domain d1hj3b1: 1hj3 B:26-133 [15931]
    Other proteins in same PDB: d1hj3a2, d1hj3b2
    complexed with dhe, gol, hec, oxy, so4

Details for d1hj3b1

PDB Entry: 1hj3 (more details), 1.6 Å

PDB Description: cytochrome cd1 nitrite reductase, dioxygen complex
PDB Compounds: (B:) nitrite reductase

SCOP Domain Sequences for d1hj3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj3b1 a.3.1.2 (B:26-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
epsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdl
trdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaa

SCOP Domain Coordinates for d1hj3b1:

Click to download the PDB-style file with coordinates for d1hj3b1.
(The format of our PDB-style files is described here.)

Timeline for d1hj3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hj3b2