SCOP 1.71: Domain d1diqc_: 1diq C:

Lineage for d1diqc_ (1diq C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
   the other subunit is a flavoprotein

7. Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries)

8. Domain d1diqc_: 1diq C: [15923]
   Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2

Details for d1diqc_

PDB Entry: 1diq, 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

SCOP Domain Sequences for d1diqc_:

Sequence; same for both SEQRES and ATOM records:

>d1diqc_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

Timeline for d1diqc_:

• d1diqc_ first appeared (with stable ids) in SCOP 1.55
  
• d1diqc_ appears in SCOP 1.69
  
• d1diqc_ appears in SCOP 1.73
  
• d1diqc_ appears in the current release, SCOPe 2.08