SCOPe 2.03: Domain d1cyca_: 1cyc A:

Lineage for d1cyca_ (1cyc A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Bonito (Katsuwonus pelamis) [TaxId:8226] [46647] (1 PDB entry)

8. Domain d1cyca_: 1cyc A: [15881]
   complexed with hem

Details for d1cyca_

PDB Entry: 1cyc, 2.3 Å

PDB Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. ii. structure and function

PDB Compounds: (A:) ferrocytochrome c

SCOPe Domain Sequences for d1cyca_:

Sequence; same for both SEQRES and ATOM records:

>d1cyca_ a.3.1.1 (A:) Mitochondrial cytochrome c {Bonito (Katsuwonus pelamis) [TaxId: 8226]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1cyca_:

• d1cyca_ first appeared (with stable ids) in SCOP 1.55, called d1cyc__
  
• d1cyca_ appears in SCOPe 2.02
  
• d1cyca_ appears in SCOPe 2.04
  
• d1cyca_ appears in the current release, SCOPe 2.08