Lineage for d5cytr_ (5cyt R:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94716Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 94767Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (4 PDB entries)
  8. 94768Domain d5cytr_: 5cyt R: [15878]

Details for d5cytr_

PDB Entry: 5cyt (more details), 1.5 Å

PDB Description: refinement of myoglobin and cytochrome c

SCOP Domain Sequences for d5cytr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cytr_ a.3.1.1 (R:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d5cytr_:

Click to download the PDB-style file with coordinates for d5cytr_.
(The format of our PDB-style files is described here.)

Timeline for d5cytr_: