Lineage for d1csv__ (1csv -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149598Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 149599Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (31 PDB entries)
  8. 149616Domain d1csv__: 1csv - [15850]

Details for d1csv__

PDB Entry: 1csv (more details), 1.9 Å

PDB Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c

SCOP Domain Sequences for d1csv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csv__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafggfkkekdrndlitylkkate

SCOP Domain Coordinates for d1csv__:

Click to download the PDB-style file with coordinates for d1csv__.
(The format of our PDB-style files is described here.)

Timeline for d1csv__: