Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (46 PDB entries) Uniprot P00044 |
Domain d1yeaa_: 1yea A: [15845] complexed with hem, so4; mutant |
PDB Entry: 1yea (more details), 1.9 Å
SCOPe Domain Sequences for d1yeaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeaa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda ninknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak
Timeline for d1yeaa_: