Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c552 [46636] (6 species) |
Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries) |
Domain d1ql4b_: 1ql4 B: [15827] complexed with hec |
PDB Entry: 1ql4 (more details), 1.5 Å
SCOPe Domain Sequences for d1ql4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ql4b_ a.3.1.1 (B:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]} adpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpea lqefltnpkavvkgtkmafaglpkiedranliaylegqq
Timeline for d1ql4b_: