SCOP 1.75: Domain d1c6ra_: 1c6r A:

Lineage for d1c6ra_ (1c6r A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries)

8. Domain d1c6ra_: 1c6r A: [15807]
   complexed with cd, hem

Details for d1c6ra_

PDB Entry: 1c6r, 1.9 Å

PDB Description: crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus

PDB Compounds: (A:) cytochrome c6

SCOP Domain Sequences for d1c6ra_:

Sequence; same for both SEQRES and ATOM records:

>d1c6ra_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus) [TaxId: 3088]}
adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
pawsgtldddeiaavaayvydqasgdkw

Timeline for d1c6ra_:

• d1c6ra_ first appeared (with stable ids) in SCOP 1.55
  
• d1c6ra_ appears in SCOP 1.73
  
• d1c6ra_ appears in SCOPe 2.01
  
• d1c6ra_ appears in the current release, SCOPe 2.08