Lineage for d1c6ra_ (1c6r A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1061Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species)
  7. 1075Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries)
  8. 1076Domain d1c6ra_: 1c6r A: [15807]

Details for d1c6ra_

PDB Entry: 1c6r (more details), 1.9 Å

PDB Description: crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus

SCOP Domain Sequences for d1c6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6ra_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus)}
adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
pawsgtldddeiaavaayvydqasgdkw

SCOP Domain Coordinates for d1c6ra_:

Click to download the PDB-style file with coordinates for d1c6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1c6ra_: