Lineage for d3dwkd2 (3dwk D:293-692)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883732Protein Penicillin-binding protein 2, PBP2 [160970] (1 species)
  7. 883733Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries)
    Uniprot Q2YY56 293-692
  8. 883740Domain d3dwkd2: 3dwk D:293-692 [157920]
    Other proteins in same PDB: d3dwka1, d3dwkb1, d3dwkc1, d3dwkd1
    automatically matched to 2OLV A:293-692
    complexed with lda, so4

Details for d3dwkd2

PDB Entry: 3dwk (more details), 3.1 Å

PDB Description: identification of dynamic structural motifs involved in peptidoglycan glycosyltransfer
PDB Compounds: (D:) Penicillin-binding protein 2

SCOP Domain Sequences for d3dwkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dwkd2 e.3.1.1 (D:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf
yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien
mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn
dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt
rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae
tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm
skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth

SCOP Domain Coordinates for d3dwkd2:

Click to download the PDB-style file with coordinates for d3dwkd2.
(The format of our PDB-style files is described here.)

Timeline for d3dwkd2: