Lineage for d3dwkc1 (3dwk C:70-292)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 851243Family d.2.1.10: PBP transglycosylase domain-like [159832] (2 proteins)
    Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase
  6. 851248Protein Penicillin-binding protein 2, PBP2 [159835] (1 species)
  7. 851249Species Staphylococcus aureus [TaxId:1280] [159836] (3 PDB entries)
    Uniprot Q2YY56 67-292
  8. 851255Domain d3dwkc1: 3dwk C:70-292 [157917]
    Other proteins in same PDB: d3dwka2, d3dwkb2, d3dwkc2, d3dwkd2
    automatically matched to 2OLV A:67-292
    complexed with lda, so4

Details for d3dwkc1

PDB Entry: 3dwk (more details), 3.1 Å

PDB Description: Identification of Dynamic Structural Motifs Involved in Peptidoglycan Glycosyltransfer
PDB Compounds: (C:) Penicillin-binding protein 2

SCOP Domain Sequences for d3dwkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dwkc1 d.2.1.10 (C:70-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
qdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldykrl
fgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifq
vylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedr
kntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnid

SCOP Domain Coordinates for d3dwkc1:

Click to download the PDB-style file with coordinates for d3dwkc1.
(The format of our PDB-style files is described here.)

Timeline for d3dwkc1: