Lineage for d3dvnl1 (3dvn L:5-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353828Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 2353851Domain d3dvnl1: 3dvn L:5-109 [157900]
    Other proteins in same PDB: d3dvna2, d3dvnb1, d3dvnb2, d3dvnh1, d3dvnh2, d3dvnl2, d3dvnu2, d3dvnu3, d3dvnv_, d3dvnx2, d3dvnx3, d3dvny_
    automatically matched to d1g9ml1

Details for d3dvnl1

PDB Entry: 3dvn (more details), 2.7 Å

PDB Description: crystal structure of k63-specific fab apu2.16 bound to k63-linked di- ubiquitin
PDB Compounds: (L:) Human IgG1 fab fragment light chain

SCOPe Domain Sequences for d3dvnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvnl1 b.1.1.1 (L:5-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsg
srsgtdftltisslqpedfatyycqqyssysslftfgqgtkveik

SCOPe Domain Coordinates for d3dvnl1:

Click to download the PDB-style file with coordinates for d3dvnl1.
(The format of our PDB-style files is described here.)

Timeline for d3dvnl1: