Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) SQ NA # humanized antibody Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region SQ NA # engineered antibody including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d3dvnb2: 3dvn B:121-221 [157897] Other proteins in same PDB: d3dvna1, d3dvna2, d3dvnb1, d3dvnh1, d3dvnl1, d3dvnl2, d3dvnu1, d3dvnv1, d3dvnx1, d3dvny1 automatically matched to d1ngzb2 mutant |
PDB Entry: 3dvn (more details), 2.7 Å
SCOP Domain Sequences for d3dvnb2:
Sequence, based on SEQRES records: (download)
>d3dvnb2 b.1.1.2 (B:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
>d3dvnb2 b.1.1.2 (B:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d3dvnb2: