Lineage for d3dpya1 (3dpy A:55-377)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775631Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 775632Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 775633Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 775680Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 775719Domain d3dpya1: 3dpy A:55-377 [157825]
    Other proteins in same PDB: d3dpyb1
    automatically matched to d1d8da_
    complexed with acy, fpp, zn

Details for d3dpya1

PDB Entry: 3dpy (more details), 2.7 Å

PDB Description: Protein farnesyltransferase complexed with FPP and caged TKCVIM substrate
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOP Domain Sequences for d3dpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dpya1 a.118.6.1 (A:55-377) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv

SCOP Domain Coordinates for d3dpya1:

Click to download the PDB-style file with coordinates for d3dpya1.
(The format of our PDB-style files is described here.)

Timeline for d3dpya1: