SCOPe 2.03: Domain d3dmtd1: 3dmt D:1-164,D:334-359

Lineage for d3dmtd1 (3dmt D:1-164,D:334-359)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries)

8. Domain d3dmtd1: 3dmt D:1-164,D:334-359 [157813]
   Other proteins in same PDB: d3dmta2, d3dmtb2, d3dmtc2, d3dmtd2
   automated match to d1k3ta1
   complexed with gol, nad

Details for d3dmtd1

PDB Entry: 3dmt, 2.3 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor

PDB Compounds: (D:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d3dmtd1:

Sequence; same for both SEQRES and ATOM records:

>d3dmtd1 c.2.1.3 (D:1-164,D:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

Timeline for d3dmtd1:

• d3dmtd1 first appeared in SCOP 1.75
  
• d3dmtd1 appears in SCOPe 2.02
  
• d3dmtd1 appears in SCOPe 2.04
  
• d3dmtd1 appears in the current release, SCOPe 2.08