Lineage for d3d5dz1 (3d5d Z:3-179)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412454Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2412455Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2412456Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2412491Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2412499Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 2412505Domain d3d5dz1: 3d5d Z:3-179 [157396]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1
    complexed with mg
    complexed with mg

Details for d3d5dz1

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (Z:) 50S ribosomal protein L25

SCOPe Domain Sequences for d3d5dz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5dz1 b.53.1.1 (Z:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d3d5dz1:

Click to download the PDB-style file with coordinates for d3d5dz1.
(The format of our PDB-style files is described here.)

Timeline for d3d5dz1: