Lineage for d3d5bo1 (3d5b O:1-122)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313373Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 1313374Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 1313375Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 1313376Protein Ribosomal protein L14 [50195] (5 species)
  7. 1313459Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 1313462Domain d3d5bo1: 3d5b O:1-122 [157361]
    Other proteins in same PDB: d3d5b61, d3d5b71, d3d5be1, d3d5bh1, d3d5bh2, d3d5bn1, d3d5bp1, d3d5bu1, d3d5bv1, d3d5by1, d3d5bz1
    automatically matched to 2HGJ N:1-122
    complexed with mg

Details for d3d5bo1

PDB Entry: 3d5b (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (O:) 50S ribosomal protein L14

SCOPe Domain Sequences for d3d5bo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5bo1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOPe Domain Coordinates for d3d5bo1:

Click to download the PDB-style file with coordinates for d3d5bo1.
(The format of our PDB-style files is described here.)

Timeline for d3d5bo1: