SCOPe 2.07: Domain d3csjb2: 3csj B:1-76

Lineage for d3csjb2 (3csj B:1-76)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries)

8. Domain d3csjb2: 3csj B:1-76 [156976]
   Other proteins in same PDB: d3csja1, d3csjb1
   automated match to d1aqwa2
   complexed with cbl, cl, mes

Details for d3csjb2

PDB Entry: 3csj, 1.9 Å

PDB Description: Human glutathione s-transferase p1-1 in complex with chlorambucil

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csjb2:

Sequence; same for both SEQRES and ATOM records:

>d3csjb2 c.47.1.5 (B:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d3csjb2:

• d3csjb2 first appeared in SCOP 1.75
  
• d3csjb2 appears in SCOPe 2.06
  
• d3csjb2 appears in the current release, SCOPe 2.08