Lineage for d1qlbe1 (1qlb E:107-239)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) 
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) 
Protein Fumarate reductase [46550] (3 species) Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries) 
Domain d1qlbe1: 1qlb E:107-239 [15682]
Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe2, d1qlbf_
complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4
Details for d1qlbe1
PDB Entry: 1qlb (more details), 2.33 Å
PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (E:) fumarate reductase iron-sulfur proteinSCOPe Domain Sequences for d1qlbe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlbe1 a.1.2.1 (E:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn
SCOPe Domain Coordinates for d1qlbe1:
Click to download the PDB-style file with coordinates for d1qlbe1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlbe1:
View in 3D
