SCOPe 2.08: Domain d3cmeh1: 3cme H:4-166

Lineage for d3cmeh1 (3cme H:4-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)

6. Protein Ribosomal protein L10e [54688] (2 species)

7. Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
   Uniprot P60617

8. Domain d3cmeh1: 3cme H:4-166 [156815]
   Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
   automatically matched to d1s72h_
   protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmeh1

PDB Entry: 3cme, 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d3cmeh1:

Sequence, based on SEQRES records:

>d3cmeh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records):

>d3cmeh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

Timeline for d3cmeh1:

• d3cmeh1 first appeared in SCOP 1.75
  
• d3cmeh1 appears in SCOPe 2.07