Class j: Peptides [58231] (121 folds) |
Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) |
Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
Domain d3cmeg1: 3cme G:12-73 [156814] Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1 automatically matched to 1VQ4 G:12-73 complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3 |
PDB Entry: 3cme (more details), 2.95 Å
SCOP Domain Sequences for d3cmeg1:
Sequence, based on SEQRES records: (download)
>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesrntlleraldd
Timeline for d3cmeg1: