Lineage for d1qlbb1 (1qlb B:107-239)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 44793Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 44794Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 44795Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 44799Species Wolinella succinogenes [TaxId:844] [46552] (3 PDB entries)
  8. 44802Domain d1qlbb1: 1qlb B:107-239 [15681]
    Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe2, d1qlbf_

Details for d1qlbb1

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

SCOP Domain Sequences for d1qlbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbb1 a.1.2.1 (B:107-239) Fumarate reductase iron-sulfur protein, C-terminal domain {Wolinella succinogenes}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOP Domain Coordinates for d1qlbb1:

Click to download the PDB-style file with coordinates for d1qlbb1.
(The format of our PDB-style files is described here.)

Timeline for d1qlbb1: