Lineage for d3clud2 (3clu D:192-319)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470869Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
    lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain
  6. 2470870Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)
  7. 2470873Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries)
  8. 2470876Domain d3clud2: 3clu D:192-319 [156765]
    Other proteins in same PDB: d3cluc_, d3clud1
    automated match to d1o97d2
    complexed with amp, fad; mutant

Details for d3clud2

PDB Entry: 3clu (more details), 1.8 Å

PDB Description: crystal structure of the r236k mutant from methylophilus methylotrophus etf
PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOPe Domain Sequences for d3clud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clud2 c.31.1.2 (D:192-319) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
gggndidittvdfimsigrgigeetnveqfreladeagatlccskpiadagwlpksrqvg
qsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdie
eelkaqla

SCOPe Domain Coordinates for d3clud2:

Click to download the PDB-style file with coordinates for d3clud2.
(The format of our PDB-style files is described here.)

Timeline for d3clud2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3clud1
View in 3D
Domains from other chains:
(mouse over for more information)
d3cluc_