SCOPe 2.07: Domain d3cltc_: 3clt C:

Lineage for d3cltc_ (3clt C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
   binds AMP

7. Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)

8. Domain d3cltc_: 3clt C: [156760]
   Other proteins in same PDB: d3cltd1, d3cltd2
   automated match to d1o96a_
   complexed with amp, fad; mutant

Details for d3cltc_

PDB Entry: 3clt, 2 Å

PDB Description: crystal structure of the r236e mutant of methylophilus methylotrophus etf

PDB Compounds: (C:) Electron transfer flavoprotein subunit beta

SCOPe Domain Sequences for d3cltc_:

Sequence, based on SEQRES records:

>d3cltc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinefkg

Sequence, based on observed residues (ATOM records):

>d3cltc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryastkpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtis
eqaakiiqiinefkg

Timeline for d3cltc_:

• d3cltc_ first appeared in SCOP 1.75, called d3cltc1
  
• d3cltc_ appears in SCOPe 2.06
  
• d3cltc_ appears in the current release, SCOPe 2.08