SCOPe 2.04: Domain d3cibb_: 3cib B:

Lineage for d3cibb_ (3cib B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (242 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d3cibb_: 3cib B: [156665]
   automated match to d1fkna_
   complexed with 314, tar

Details for d3cibb_

PDB Entry: 3cib, 1.72 Å

PDB Description: structure of bace bound to sch727596

PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d3cibb_:

Sequence; same for both SEQRES and ATOM records:

>d3cibb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Timeline for d3cibb_:

• d3cibb_ first appeared in SCOP 1.75, called d3cibb1
  
• d3cibb_ appears in SCOPe 2.03
  
• d3cibb_ appears in SCOPe 2.05
  
• d3cibb_ appears in the current release, SCOPe 2.08