Lineage for d3chsa2 (3chs A:1-208)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333802Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1333803Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) (S)
  5. 1333804Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)
  6. 1333805Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 1333806Species Human (Homo sapiens) [TaxId:9606] [63740] (44 PDB entries)
    Uniprot P09960
  8. 1333850Domain d3chsa2: 3chs A:1-208 [156654]
    Other proteins in same PDB: d3chsa1, d3chsa3
    automatically matched to d1gw6a2
    complexed with 4bu, imd, yb, zn

Details for d3chsa2

PDB Entry: 3chs (more details), 2.55 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with (2s)-2- amino-5-[[4-[(2s)-2-hydroxy-2-phenyl-ethoxy]phenyl]amino]-5-oxo- pentanoic acid
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3chsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chsa2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d3chsa2:

Click to download the PDB-style file with coordinates for d3chsa2.
(The format of our PDB-style files is described here.)

Timeline for d3chsa2: