![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (7 PDB entries) MTS1 protein |
![]() | Domain d3cgaa_: 3cga A: [156615] automated match to d1m31a_ complexed with ca |
PDB Entry: 3cga (more details), 2.03 Å
SCOPe Domain Sequences for d3cgaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cgaa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} plekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnld snrdnevdfqeycvflsciammcneff
Timeline for d3cgaa_: