SCOPe 2.08: Domain d3cfkg2: 3cfk G:108-212

Lineage for d3cfkg2 (3cfk G:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d3cfkg2: 3cfk G:108-212 [156594]
   Other proteins in same PDB: d3cfka1, d3cfkb1, d3cfkb2, d3cfkc1, d3cfkd1, d3cfkd2, d3cfke1, d3cfkf1, d3cfkf2, d3cfkg1, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj1, d3cfkk1, d3cfkk2, d3cfkl1, d3cfkm1, d3cfkn1, d3cfkn2, d3cfko1, d3cfkp1, d3cfkp2
   automatically matched to d1g9ml2
   complexed with b3p, cd, gol

Details for d3cfkg2

PDB Entry: 3cfk, 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form

PDB Compounds: (G:) CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein

SCOPe Domain Sequences for d3cfkg2:

Sequence; same for both SEQRES and ATOM records:

>d3cfkg2 b.1.1.2 (G:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3cfkg2:

• d3cfkg2 first appeared in SCOP 1.75
  
• d3cfkg2 appears in SCOPe 2.07